PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000358.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 291aa    MW: 33631.6 Da    PI: 5.1305
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000358.1_g00015.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.25.3e-4361332128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              ppG+rF P+d e++++yL+ k+ +  l+  ++i+ev++yk+ P++L  +    ++e+e+y F++rd+ky++g+r++ra+ +gyWka
  Itr_sc000358.1_g00015.1   6 PPGIRFVPSDYEVIHYYLELKIMNCALPY-NHIREVNLYKYSPEELSgMyPRPEGENELYVFTPRDRKYRNGTRPKRAAGNGYWKA 90 
                              9****************************.88**************843322347789**************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tg dk++++  + ++g kktLv+y+g+ p+gekt+W+mhey++
  Itr_sc000358.1_g00015.1  91 TGADKPITHGAHCVIGYKKTLVYYEGKPPNGEKTNWIMHEYTV 133
                              *********99999***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-513161IPR003441NAC domain
PROSITE profilePS5100548.9265161IPR003441NAC domain
PfamPF023653.7E-216132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MVQSFPPGIR FVPSDYEVIH YYLELKIMNC ALPYNHIREV NLYKYSPEEL SGMYPRPEGE  60
NELYVFTPRD RKYRNGTRPK RAAGNGYWKA TGADKPITHG AHCVIGYKKT LVYYEGKPPN  120
GEKTNWIMHE YTVKDAKTPK LRRDADPMRL DDWVLCRIYN KTDKGAGCTQ KEDENNVEAN  180
TSPPPPPPPP HDEENVEVQE VKFDEESVEV QEVKFSFPHN EMTFHNAFEF GNDPIYDDAQ  240
FIDSDSDSFI PEIIYNQPLD FHIDHILSSQ NVESPTLKPL TPQRDKTSGR I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-47416414171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603097.12e-64PREDICTED: NAC transcription factor 29-like
RefseqXP_016487930.12e-64PREDICTED: NAC transcription factor 29-like
SwissprotA2YMR02e-52NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A061GZA82e-61A0A061GZA8_THECC; NAC domain transcriptional regulator superfamily protein, putative
STRINGSolyc11g065540.1.17e-60(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-54NAC domain containing protein 32